PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00677g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 284aa    MW: 32027.6 Da    PI: 7.2181
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00677g00012.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.65.7e-13135179347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT+eE++l++ + + +G+g+Wk I+r     +t+ q+ s+ qky
  Peaxi162Scf00677g00012.1 135 PWTEEEHQLFLMGLNTFGKGDWKNISRVYVVSKTPTQVASHAQKY 179
                               7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00463183IPR001005SANT/Myb domain
PROSITE profilePS500905.033181IPR017877Myb-like domain
SuperFamilySSF466892.94E-63381IPR009057Homeodomain-like
CDDcd001670.002213581No hitNo description
PROSITE profilePS5129417.249127184IPR017930Myb domain
SuperFamilySSF466899.33E-17129185IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-17132183IPR006447Myb domain, plants
SMARTSM007171.4E-10132182IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-9133181IPR009057Homeodomain-like
PfamPF002491.7E-10135179IPR001005SANT/Myb domain
CDDcd001675.88E-10135180No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MEWQKFLHSN SQESTFGQFN APHINHEVVE KTGQWTLEEK QVFDNALSKL NPASPSFFDY  60
VASILPHKSL EEIKNHYLNL FLIPENNVVA AADDDYDPDH QHYQLPQADD SDMVGRPVSS  120
PQVEYNRPRR RKGIPWTEEE HQLFLMGLNT FGKGDWKNIS RVYVVSKTPT QVASHAQKYF  180
NRQNSTTPLG RRRPSINDIQ TVTLAPASTT THQINGTLAQ GASSMPSLHY PYNVAPMSSG  240
HGNFGRFFSG AEASSSSSNN MVQQTINCNN INIHLKPVSP RPFF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127131PRRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009622214.11e-103PREDICTED: transcription factor DIVARICATA-like
TrEMBLK4BAA98e-65K4BAA9_SOLLC; Uncharacterized protein
STRINGSolyc02g082390.1.12e-64(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52342032
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.28e-36MYB family protein